Mk7 gti best downpipe CTS Turbo - Downpipe with Catalytic Converter for MK7 GTI 3. Is there a performance difference? I'm not super into loud so Im defintly doing a down pipe but I may go back to the stock catback. The software uses the vehicle acceleration data, in this case, recorded using a Cobb Accessport, along with information about the Mk7 GTI, to calculate the wheel horsepower. Performance Pack), MK7 VW GLI, MK7 Golf 1. Add to cart This Unitronic Turbo-Back Exhaust System for the MK7/MK7. 52 Jan 14, 2015 · Downpipe is stainless steel, catback is titanium. product code: DR10076. Mar 1, 2015 · Best way to fix a CEL on a MK7 with a DP is a tune. Mar 15, 2021 · You can equip this part on a bone stock Mk7 GTI and notice instant improvements in throttle response from reduced back-pressure. Nov 11, 2020 · However, their Volkswagen MK6 GTI downpipe has great reviews and the price is tough to beat. Our Top Pick on Yeah my gti was running a catless downpipe with an exhaust and an air intake with no tune for a while, it’s bad for the car cause I guess the computers can’t tune the air fuel mixture enough to make the engine run 100% efficiently because of all the airflow leaving the engine. I put my IE catted downpipe on a 120 miles or so ago and just tripped the CEL. Jun 19, 2020 · MK7. 5" body, the ARM MK7 4. We are proud to release the new CTS Turbo 3. 93MPH - Fastest and Quickest IS38 in the World! We welcome discussion of all things about the VW GTI as well as other VW hot hatchbacks. The IE Audi & VW downpipes are the best bolt-on mod for your stock or K04 turbo. However, one of the things I have on my bucket list is a backfire-shooting burble popping exhaust. What downpipe and if they detune or do they take the pipe off. 0T engines in front-wheel drive (FWD) vehicles only. Great for going stage Apr 4, 2021 · If you are genuinely looking to go downpipe and stage 2, you should figure out what Intercooler you're going to buy as well. 5. 5" cast section at the turbo outlet, the Bull-X downpipe is for those looking to make the most power. Get the best in automotive performance parts with Powerpipes and Autostyle You would need a DP with a HJS cat, Fabspeed makes DP with HJS cat which will not throw a CEL. Do I “have” to tune my Mk7 GTI if I buy a downpipe? Let’s play devil’s advocate first. I plan on purchasing and installing a DP in the next few months and I have narrowed it down to a handful of options. GOLFMK7 MK7 Golf GTI High Flow Catted Downpipe. The ARM MK7 4. About Press Copyright Contact us Creators Advertise Developers Terms Privacy Policy & Safety How YouTube works Test new features NFL Sunday Ticket Press Copyright Apr 16, 2021 · 2017 1. Aug 17, 2020 · 2018 Mk7. -sourced T304 stainless steel Dyno-developed and street-proven on the AWE in-house MK7 102mm dual tip 2015 – 2021 MK7 / MK7. Unfortunately, the factory downpipe that comes as standard equipment in your car was designed for anything but performance. go JB1->JB4 upgrade. Otherwise, it can’t hurt to opt for a well-priced product. 5 GTI and was initially really happy with how tame it sounded. 5″ Stainless Steel High-Flow Cat for the front-wheel drive MQB vehicles such as MK7 GTI (incl. 2015 DBP GTI S 6 spd- Eurodyne stg2, gfb dv+, neuspeed pflo cai, p3 vent gauge, diesel geek sigma 6, bfi catch can, awe tbe, 034 dogbone insert v1, Haus of Dubs 6GT clutch, IE cooler, BFI st2 mounts, 18x8 flowone f3s, cooper Feb 23, 2015 · Reported wheel figures measured on APR's in house Dynapack Dynamometer with a 2014 MK7 Golf Tiptronic and 2014 MK7 GTI DSG, using SAEJ1349 correction and an average of multiple runs. This solid-unit construction eliminates the exhaust leaks and installation issues commonly found with it's multi-piece downpipe counterparts. The ARM MK7 GTI Catted Downpipe is constructed of a single piece design. It won't really give you anything without the proper software (also if there are no emissions testing where you live there are zero reasons to not go stage 2 vs. 5 – VW Golf GTI / TSI Downpipe with Hi Flow Cat $ 349. Did not realize that certain items catering to the IS20 will not fit the IS38. S. Jan 18, 2021 · Mk7 GTI Tunes Menu Toggle. 0T. 5" Stainless Steel Downpipe for MQB vehicles like MK7 GTI and MK7 Golf 1. 5 Jul 19, 2017 · The stock downpipe is the only major restriction in any mk7 exhaust 1. Compatible with OEM catback with our "slip fit" adapter or make it a true 3" turboback system when pairing with our Ultimate Racing Catback Exhaust. This also sucks MK7 / 7. Sep 8, 2015 · 2015 GTI 2DR S PP 6MT | 100k mile club | IS38 | APR Downpipe & IC | Eurodyne/Maestro | Neuspeed Race RSB | RSR Clutch | StopTech/Redstuff Feb 4, 2015 · It changes the cars entire power band from top to bottom. I have had the original one for 14k miles now and after two adjustments it has been problem free ever since. Hi all, New 2020 MK7. Installed a Vibrant resonator between the stock mid-resonator and rear muffler. I did notice that I installed it with the O2 sensor facing downward. When using that downpipe, I ran it without the Vibrant midpipe for some time, and it was definitely too much. Members Online APR Stage 1 on 2012 MKVI Questions Feb 21, 2021 · Im thinking of running an EQT "stage 2" tune in the future and I dont know if a high flow cat or catless downpipe would be best. It does not drone when driving and it gives it a great sound. 2 out of 5 stars 7 Apr 30, 2018 · Does anyone know or have any opinions about running a catless downpipe along with an O2 spacer for downstream sensor? Should I just run it without one or continue to run it with the spacer? I do not mind s CEL just want what is best for my cars health. This result is a surprising 10% increase over two other catless downpipes that have been tested (~240% over the stock GTI downpipe). 8T & 2. Spool up was reduced slightly and felt like it came on more gradually (good for traction) but from the mid-range to redline the car feels much smoother and pulls harder, especially past 5500rpms. What tune and stage. 0 tsi (MQB platform cars) We are proud to release the new CTS Turbo 3. 1 Eng+Trans Mounts/APR Pendulum Mount/AFE Intake/APR TIP/Forge TMD/Ultimate Racing Resonated DP/Remus Axleback/Sachs Performance Clutch/Neuspeed Short Shifter/42 DD Shifter Bushings/ECS Clutch Bleeder/ECS Clutch Line/Fluidampr/DG Springs/Bilstein B8's/EuroCode F+R Chassis Bars/ECS Front Subframe Brace/Unibrace Mar 30, 2016 · I found Stage 2 with APR catted downpipe to be much louder than Stage 1 with stock catted/resonated downpipe. Made of TIG welded T304 grade stainless steel, the ARM MK7 GTI Downpipe is designed to fit your MK7 GTI perfectly. Has anyone encountered this problem on the newer MK7? Aug 5, 2017 · Best OEM-like downpipe. It's best to get a downpipe first and then add an exhaust based around what you'd like to change. MK6 GTI Feb 10, 2016 · Someone educate me on the difference between a catted DP and a Catless please. 5 GTI and TCR Pipework Diameter - 3. 5 2. Mk7 GTI Stg2 Tune Overview; Cobb OTS Stg2 Tunes; Mk7 GTI Air Intake; Mk7 GTI Charge Pipes; Mk7 GTI Downpipe Testing; Mk7 GTI Exhaust Tests; Mk7 GTI FMIC Tests; Mk7 Intake Manifold Tests; Mk7 GTI Intercooler Test; Mk7 Radiator Tests; Mk7 Turbo Inlet Hose Test; Mk7 Turbo Inlet Elbow Tests; Mk7 GTI Turbo Muffler Delete Go for a custom made downpipe or a downpipe from Alibaba/Aliexpress. We offer a variety of performance downpipe options from the top brands in the industry such as AWE Tuning, CTS Turbo, Neuspeed and Unitronic. The CTS Turbo downpipe will allow for I recently installed a mbrp catback exhaust to my mk7. And now here it is, gone is the 200 CEL racing cat, in its place is just the hollow pathway that quickens the exhaust gas’s release. 5 R down pipe. Jun 6, 2017 · I have a apr stage 2 tune with apr downpipe and apr dsg tune. Unleash more power, and experience an exhilarating driving experience. OP, Reader's Digest version is that the spectrum of loudest to quietest is catless/no res, catted/no res, catless/res, catted/res. System comprises of: - Downpipe with 200 Cell Sports Cat or De-Cat - Fitting Kit Notes: - Engine management light may be activated if not used in conjunction with the correct performance software Ideal for BMW enthusiasts looking to upgrade their vehicle, this downpipe boosts exhaust flow and turbo efficiency, resulting in improved horsepower and torque. I'm about to go IS38. 5 GTI If you're looking to increase horsepower and torque after installing a new engine or turbo on your MK7 GTI, then you should upgrade your stock downpipe with a high-flow MK7 catted downpipe. The ARM MK7 GTI Catted Downpipe is an essential upgrade if you're looking to get the most from your Gen 3 EA888 equipped GTI. The ARM MK7 GLI Downpipe is constructed of a single piece design. Milltek Downpipe Options - VW Golf Mk7 and Mk7. Jul 20, 2017 · I have a Mk7 GTI. It's a full 3" (76mm) system with a coupler to mate to the stock exhaust. 8TSI (FWD only, not Quattro). Due to the physical decrease in restriction post turbocharger the car will absolutely react different ad become quicker and more responsive. Long story short, i have a APR Stage 1 MK7 GTI, with an Injen Intake and wanting to spend that sweet tax refund money on Stage 2. 5″ Stainless Steel Catless for the front wheel drive MQB vehicles such as MK7 GTI (incl. Save $130 with the same cat and less leak points (compared to the usp pipe). Replacing your OEM downpipe with the ARM MK7 GTI Downpipe will significantly improve exhaust flow. The reason you see the 50/50 split is because a downpipe is the biggest change you can make to the sound of your car. 5 GTI CATLESS DOWNPIPE T304 We heard you… Ever since the release of our ever popular MK7 GTI Turbo back exhaust we heard the request to chase away the cat. We have a great online selection at the lowest prices with Fast & Free shipping on many items! Mk7 Gti Downpipe for sale | eBay Jun 7, 2021 · 2018 Mk7. The ECU can compensate to make up for the difference, but not drastic enough to safely run the engine long term. Shop now! Made of TIG welded T304 grade stainless steel, the ARM MK7 GTI Catted Downpipe is designed to fit your MK7 GTI perfectly. 8TSI. Replacing your OEM downpipe with the This GTI MK7 / MK7. We’ve also seen performance benefits of anywhere from 5 to 25whp from a downpipe only. Oct 26, 2018 · Does it matter what brand down pipe buy . Looking for something cheap, yet good quality and with good fitment and such. Car would be custom tuned for the DP, most likely adding HPFP/LPFP for 93 and E85 tunes. I don't wanna deal with a CEL I have a mk7 gti jb1 and catback. Who's the best ! Or does it matter. 5″ Stainless Steel downpipe for the front wheel drive MQB vehicles such as MK7 GTI (inc View full details $1,099. Im seeing that eurodyne offers a 98 octane file. 5 GTI 6MT HPA IS38+/APR IS38 High TQ/Majesty IC/Powerflex Hybrid Bushing/BFI Stg. 3 engine features a CFD optimized upper downpipe section with a GESi 5" UHO+ catalytic converter which flows into 3-inch T304 Stainless Steel mandrel bent tubing, a high density, high temperature fiberglass wool packed muffler and high quality v-band fasteners with T316 Stainless Steel flanges. 0 TSI EA888. Have an Oettinger quad-tip exhaust. 5 VW Golf GTI with our high-performance Downpipe Kit. r/GolfGTI is best viewed with dark/night mode. These software tweaks will enable your engine to take full advantage of the huge restriction you just removed between your turbo and cat-back exhaust. Or get one custom made with a nice EPA-approved GESI cat. Presenting the Volkswagen MK7 GTI Exhaust Suite by AWE: Unlocks a potent max gain of 21 hp and 24 ft-lbs of torque at the crank -- without software, when paired to an aftermarket downpipe Crafted from 3" and 2. Featuring 304-grade stainless steel pipework, the larger bore downpipe also includes a high-flow 200-cell catalyst and stainless That day came, I own a mk7 GTI, and I've learned a lot about these cars. Lower cell count like 200 use medium). Furthermore, what brand(s) would be best to try and stick with in that regard. com/awesome amazon list of tools & necessities -http://bit. What is the best upgraded MK7 GTI downpipe for performance? Best sound, horsepower gains, etc. Get the best deals for Mk7 Gti Downpipe at eBay. 25" U. Full stainless steel construction. The stock downpipe robs your EA888 engine with high back pressure suffocating your turbo and stifling your power goals. The downpipe is from BCS/Powervalve in the UK. If you get an exhaust and then a downpipe, it might end up being too loud or sounding awful. 5 GTI. Just make sure it's not a 304 stainless steel because these rust real quick. 0T 3. Oct 21, 2019 #7 Thank you guys for the response and information. - Does anyone have suggestions on solidly built and well engineered downpipes with built-in 200 cel cat Rev9 CB-071A FlowMAXX Stainless Steel Cat-Back Exhaust System, Rolled Tip, Free Flow Design, compatible with Volkswagen Golf GTI MK7. 0T Gen3, Volkswagen Golf VII Hatchback 1. 5 GTI and TCR. Adding an aftermarket MK7 downpipe to your GTI or Golf R is one of the best ways to increase performance and add an aggressive growl to your MK7 VW. Performance Pack), MK7 Jetta GLI, MK7 Golf 1. 5 Gti Autobahn PP : Eqt Vortex XL tune by Stratified, Dsg tuned Apr Dtr6054 file, Mamba 3" turbo inlet, Dbv2 Tmd, Apr coil packs + spark plugs, Mishimoto charge pipes, Ie v2 intake, Custom Vibrant Fmic, Custom 4" dp, Apr v2 Catch can, Apr cat back, Ecs street shield and exhaust tunnel, Superpro Lcas, Bfi Stage 2 mouts, Apr pendulum Aug 16, 2021 · Mk7 GTI Tunes Menu Toggle. Made of TIG welded T304 grade stainless steel, the ARM MK7 GLI Downpipe is designed to fit your MK7 GLI perfectly. Before getting the Bull-X downpipe, I had the MAP catted/resonated downpipe, it was definitely more loud and not as civil as the Bull-X one. Jan 30, 2021 · With so many options for The Best Downpipe for MK7 GTI available in the market, it is difficult to choose between the good and the bad ones. 1@125. This really discourages me from getting a downpipe. 1 Eng+Trans Mounts/APR Pendulum Mount/AFE Intake/APR TIP/Forge TMD/Ultimate Racing Resonated DP/Remus Axleback/Sachs Performance Clutch/Neuspeed Short Shifter/42 DD Shifter Bushings/ECS Clutch Bleeder/ECS Clutch Line/Fluidampr/DG Springs/Bilstein B8's/EuroCode F+R Chassis Bars/ECS Front Subframe Brace/Unibrace Mar 29, 2021 · IMO the best catted DPs on this platform are AMS, DBV2, Bull-X, and AWE. About 4 months ago I installed an Integrated Engineering downpipe on my 2019 MK7. Those options are IE, Trackslag, Cobb, HPA and MAP. The Trackslag is equipped with a large (as seen in the top picture) 200 cell catalytic converter. Nov 17, 2020 · Learn all about an upgraded MK7 GTI downpipe. Jan 16, 2018 · I think it is hands down the best sounding exhaust for these vehicles. Nov 12, 2016 · If you're looking to save some money go with the CW pipe. Sep 24, 2015 · If you have aftermarket downpipe installed and not stage 2 or more, you will get a CEL most likely. Oct 11, 2017 · To fully take advantage of a downpipe on your MK7 GTI, an ECU upgrade is required. Proper fitment with quality stainless steel construction is about all you need. Milltek offer a fantastic large bore downpipe and sports cat for the MK7 Golf GTI. Buy Here: GTI 2. I know I need a downpipe which is obviously illegal in CA and I’m wondering if it’s a common thing for people to do? If so what are the best options for downpipes? Oct 21, 2019 · Mk7. 8T and 2. 8T Gen3, Volkswagen Golf VII Sportwagen 1. GTI & Golf MK7 General Discussions. 5 2018-2020 2. Volkswagen GTI / Golf MK7 General Topics. 9MPH 2016 Audi A3 - Tried an expensive Golf 2016 GTI SE - Whatever 2019 GSW 4Mo - The IS20/IS38 GPOP Combo, OEM MPI, Autotech HPFP - Reflect Flex Tune 11. Crank figures estimated based on the measured wheel figures. Unleash power with CTS Turbo's 3. With it's full 4. When searching, Depo Racing's Sep 20, 2021 · The Trackslag downpipe flows 429 CFM @ 16″ of H2O which is approximately 150% more than the stock Mk7 GTI downpipe under the conditions described for this test. Do some research and look at some reviews for some catted DP. It's also equipped with a high-flow performance catalytic converter that reduces unpleasant smells and minimizes unwanted cabin drone. It actually rips a hole in the exhaust. Dec 11, 2023 · The Trackslag 4″ downpipe for the Mk7 GTI without a catalytic converter was flow tested using a PTS flow bench. A direct factory replacement from MAPerformance will do the trick! We have a Nov 8, 2017 · While catback’s sound awesome, the exhaust portion isn’t nearly as critical as the downpipe in terms of performance. 2mm) Kit Includes: - De-Cat Downpipe (for De-Cat Option)- HJS High Quality 200 Cell Cat Downpipe MSRP: £557. 69 For VW Golf GTi owners that want to achieve peak power and torque output, or that just like their exhaust system fully optimised whilst retaining a catalyst, the XFORCE 3” downpipe delivers. 8t jettas Have hs issues with the downpipe breaking at the hangers. and buy GTI Jakes downpipe. Aug 17, 2020 · 2015 MK7 Golf R Aug 16, 2020 what are y’alls opinions on best downpipe? aaronc7 Autocross Champion. Other features include: Made in Germany High Flow 200-cell German catalyst T304 stainless steel left to a raw bead blasted finish to show the material quality. We carry the highest-quality variety of performance downpipe options on the internet. Jun 6, 2020 · Catted downpipe with the cat BEFORE the o2 sensor = Vibrant Adjustable straight spacer with medium or large insert depending on the cell count of the cat (higher cell count 300+, use large. shipping: Free Shipping to the lower 48 states Depo Racing 2015 Definitely go with a catted downpipe, as it does increase the sound quite a lot. product code: DR10075. Mk7 GTI Stg2 Tune Overview; Cobb OTS Stg2 Tunes; Mk7 GTI Air Intake; Mk7 GTI Charge Pipes; Mk7 GTI Downpipe Testing; Mk7 GTI Exhaust Tests; Mk7 GTI FMIC Tests; Mk7 Intake Manifold Tests; Mk7 GTI Intercooler Test; Mk7 Radiator Tests; Mk7 Turbo Inlet Hose Test; Mk7 Turbo Inlet Elbow Tests; Mk7 GTI Turbo Muffler Delete For the best selection of aftermarket MK7 downpipe products, there's no better place to buy than at MAPerformance. 5 Gti Autobahn PP : Eqt Vortex XL tune by Stratified, Dsg tuned Apr Dtr6054 file, Mamba 3" turbo inlet, Dbv2 Tmd, Apr coil packs + spark plugs, Mishimoto charge pipes, Ie v2 intake, Custom Vibrant Fmic, Custom 4" dp, Apr v2 Catch can, Apr cat back, Ecs street shield and exhaust tunnel, Superpro Lcas, Bfi Stage 2 mouts, Apr pendulum Jul 9, 2020 · Hey guys , I need some advice. Regardless someone please give me the pros and cons of both. If removal is recommended, is it possible to remove it with the downpipe still in place or will it require removal of the downpipe? I'm curious what will be recommended. This downpipe is brilliantly put together to ensure maximum performance without the loss of any mid range torque. Milltek GPF Delete Downpipe Options - VW Golf Mk7. Raceland DP Price: $179. Nov 22, 2019 · If you're not going stage 2 there is no reason to get an aftermarket down pipe. 87@114. What's the best downpipe for the money? I understand that at a certain point cheap isn't always the best. Upgrade your MK7 & MK7. 15' GTI PP/LP/DSG: 11. This CTS 3. For the best selection of aftermarket MK7 downpipe products, there's no better place to buy than at MAPerformance. 5" Downpipe is the perfect downpipe upgrade to support any build. Cast outle r/GolfGTI is a place for GTI enthusiasts to discuss and share information related to the best car that can be had for less than $40K. We entertain beauty shots and thrive on discussing mods, whether purely cosmetic, functional, or both. We welcome discussion of all things about the VW GTI as well as other VW hot hatchbacks. I used the medium spacer in the end. Downpipe makes most of stage 2 power, but stage 2 tune itself, gives the full benefit of downpipe power gain and eliminated CEL, as well as smoother power band and rips up the redline, unlike stage 1 where it dies off at 5k RPM. The connection between the downpipe hangers and the bracket with the orange rubber pieces appears to have being revised for the model year 2020. Sep 16, 2020 · Half (?) throttle, stock resonator. The ones you're looking at will cut down on a bit of the smell and noise, but if you're pushing them on power, it won't be long til you just have an expensive semi-catted DP. Shop from the best aftermarket high flow, high quality MK7 GTI downpipes at the lowest price on the web, guaranteed thanks to the MAPerformance +1, I have the Remus turbo-back (Remus down pipe makes a huge sound difference in a really good way) with the res and muffler. Aug 2, 2021 · Conclusions: The ARM Motorsport catted downpipe flows roughly 216 CFM (128%) more than the stock GTI downpipe at 16″ of H2O. I want to rev it up to 5k and let off the throttle and bask in the auditory glory that is unburnt fuel hitting a downpipe. 8T/GTI/R. I have asked apr if they are doing anything with a e85 tune and they said no. I believe the Jb4 eliminates the CEL if im correct if you decide with a catless USP 3" Stainless Steel Downpipe For MK7 GTI, Golf, A3 FWD (Catted) Brand Description: USP Motorsports offers thousands of products from hundreds of manufacturers. Downpipe is a direct factory replacement, no modification required. Sportwagen FWD), MK7 VW Beetle 1. The ARM MK7 GTI Downpipe is constructed of a single piece design. If you leave it in place the stock resonator is sufficient for eliminating drone (buzzing, unpleasant vibrations felt through the chassis of the carcan cause headaches and fatigue and is overall tiring after any amount of time) regardless of what you choose to do r/GolfGTI is a place for enthusiasts to discuss, ask questions, and share information about the best car that can be had for less than $40K. Unfortunately, Read More "CTS Turbo MQB FWD Exhaust Downpipe with HIGH FLOW CAT (MK7/MK7. 5 GTI that includes a CARB-certified cat? As of 2021, Colorado requires this for all non-OEM cat replacements. 0T engine; VW - Golf MK7 1. I really want to know how PA folks deal with PA inspections. 5 Golf, GTI, GLI, A3 FWD)" Trying to achieve the best exhaust setup for my MK7 GTI in this video; discussing downpipes. 5" Downpipe gives you unsurpassed exhaust flow and sound for your 2. 5 – VW Golf GTI / TSI Downpipe Catless $ 269. Members Online Got run off the road by a Dodge Ram, back-over-front rollover, landed upside-down. Any commentary would be such a good help, Thanks! Mk7 GTI Cobb catback post: Mk7 GTI APR catted DP + Remus resonated catback post: Mk7 GTI CTS catted DP + Remus resonated catback post: Mk7 GTI MAPerformance catted/resonated DP + APR front resonator + CSS Muffler post: Mk7 GTI Jan 4, 2018 · MK7 GTI Performance Pack - APR Stage I Powervalve catback (WRC variant) Sachs organic clutch ECS tuning drilled and slotted discs Rieger rear diffuser Maxton Design front splitter Oct 23, 2020 · Does anyone know of a downpipe for the Mk7. For me, it was too loud, especially under throttle. 2mm) Kit Includes: - De-Cat Downpipe (for De-Cat Option) - HJS High Quality 200 Cell Cat Downpipe (for HJC Option) - Race Cat 200 Cell Downpipe (for Race Cat Option) - Connecting Pipe Notes: - Requires Stage 2 Mapping Apr 11, 2017 · Interesting. Shop from the best aftermarket high flow, high quality MK7 GTI downpipes at the lowest price on the web, guaranteed thanks to the MAPerformance Aug 17, 2021 · After lots of back and forth on deciding what exhaust setup to get, I finally found the perfect setup for MK7. The spacer may work at times, but mine randomly throws a code for "Delayed Sensor Response" code even with a very short elbow spacer. ly/toolsfromcamMore Content - carmaspeed podcast - https Nov 5, 2020 · I bought a mk7 GTI a couple months ago, went stage 1 and am looking to go stage 2. 2mm) Kit Includes: - De-Cat Downpipe (for De-Cat Option) - HJS High Quality 200 Cell Cat Downpipe (for HJC Option) - Race Cat 200 Cell Downpipe (for Race Cat Option) - Connecting Pipe Notes: - Requires Stage 2 Mapping - NOT SUITABLE FOR GPF EQUIPPED VEHICLES Looking for no-CEL DP recommendations for my GTI. Quiet when you’re cruising, but the perfect tone and volume when you’re half to full throttle, full throttle is loud, but in a good way. Built to last with 304 stainless steel and engineered for dyno-proven power gains. 8TSI, MK3 Audi TT (FWD only) and 8V Audi A3 1. I will solve any CEL issues with an O2 spacer and will be putting the car on map 2 JB4 after the install. The result of the increased exhaust flow is faster turbo spool, increased power and torque, and a nice improvement in exhaust note. So the APR downpipe and Aug 16, 2023 · Scorpion Downpipe and Cat / De-Cat - Volkswagen Golf Mk7 'R' Features: - 3" Diameter Stainless Steel Pipework - Stage 2 Remap Required. 981 @ 114. Yeah I was looking at them. We welcome discussion of all things GTI as well as other VW hot hatchbacks. MK7 GTI/Golf R Downpipe The ARM MK7 GTI/Golf R Downpipe is an essential upgrade if you're looking to get the most from your Gen 3 EA888 equipped GTI/Golf R. It does sound a bit deeper, and a few more burbles, but the difference is subtle. Unfortunately, Read More "CTS Turbo MQB FWD Exhaust Downpipe (MK7/MK7. The first commercially available, off the shelf, 4" Downpipe for Mk7 Golf Gti, Leon III Cupra, A3 2. All-wheel drive (AWD) Quattro, or 4 Motion vehicles Mar 3, 2017 · 2016 GTI SE 6MT IS38, ED Maestro, CTS DP, IE Intercooler, IE Closed Air Intake, CTS TIP, Neuspeed Charge Pipe/TMD-----1995 Mitsubishi 3000GT VR4 Dec 25, 2021 · The downpipe actually makes quite a bit of difference. Personally I'm waiting to get my car back so I can slap a Trackslag downpipe on it. shop carmaspeed gear - https://carmaspeed. com/lucashuangENAMEL PINS — htt Integrated Engineering is your source for Audi S3 TT Quatro & VW Mk7 Golf R Downpipes. 00 r/GolfGTI is a place for GTI enthusiasts to discuss and share information related to the best car that can be had for less than $40K. Oct 9, 2015 · Not sure about the quality of the mk7 downpipe from CT’S but I know that a lot of guys with the Gli and 1. 5 1. Is it Large-bore Downpipe and De-cat - Must be fitted with a Milltek Sport cat-back system - Golf - MK7 GTi (including GTi Performance Pack Clubsport & Clubsport S models) - 2013-2016 - SSXVW262_1 MSRP: £481. We entertain beauty shots and thrive on discussing mods whether they're cosmetic, functional, or both. Jan 29, 2021 · Looking for some help. The ARM MK7 GTI Downpipe is an essential upgrade if you're looking to tune your Gen 3 EA888 equipped VW. INSTAGRAM — https://www. Boost horsepower and aesthetics affordably! PROFILE. I contacted the VW dealer (APR partnered), and asked about going stage 2. Members Online Accomplished-Ad-7913 Feb 20, 2017 · Hello All! Thank you for taking your time and reading my post. Feb 24, 2018 · 2017 GTI Sport - DSG - Pure White Engine: EQT Vortex + Tune, Integrated Engineering Intercooler, Downpipe, & Carbon Intake, CTS Catback, BFI Stage1 Mounts Suspension: VWR Springs, Koni Sport Shocks/Struts, H&R 24mm RSB, StopTech ST-60 BBK, Neuspeed RSE10 & Michelin Pilot Sport 4s Apr 22, 2022 · MK7. Whether you are running the stock IS20, upgraded IS38, or hybrid turbo, the ARM 4. Pipework Diameter - 3. I had a Neuspeed DP with the HJS cat on my mk7 GTI, and i never had a CEL on with no tune. AERO Go Kart Newbie. 8T Gen3. shipping: Free Shipping to the lower 48 states. Thread starter alper; Start 2019 GTI / APR DTR6054/ Unitronic Intercooler/ APR catchcan/ Mishimoto intercooler pipes/ 034 High Flow air This is the catted downpipe by Depo Racing. 5 Gti Autobahn PP : Eqt Vortex XL tune by Stratified, Dsg tuned Apr Dtr6054 file, Mamba 3" turbo inlet, Dbv2 Tmd, Apr coil packs + spark plugs, Mishimoto charge pipes, Ie v2 intake, Custom Vibrant Fmic, Custom 4" dp, Apr v2 Catch can, Apr cat back, Ecs street shield and exhaust tunnel, Superpro Lcas, Bfi Stage 2 mouts, Apr pendulum mount, Powerflex hybrid race puck, Hotchkis rsb, Ecs Dec 27, 2017 · It was a pain to install the APR downpipe to a 3 inch catback because of all the reducers. 0T engine; VW - GTI MK7. Interested in Stage 2, but don't know if spending $1000+ with labor and tune is worth it just for pops and bangs. 90. 8T | APR IS20 Tune | ARM Catted DP | CTS TIP | Modified Stock Intake | GTI Exhaust | 2016 Miata Club Sep 13, 2017 · 20 17 GTI Sport - Deer to Roof Mod 2017 Alltrack SEL - 352 whp / 350 ft/lbs - 11. Transform your BMW with the PowerPipes Golf 7 GTI Downpipe for and enjoy a noticeable performance boost. stage 1 if you have a downpipe). If you want to avoid being cheap, the Trackslag is the best choice. 5″ Stainless Steel downpipe for the front wheel drive MQB vehicles such as MK7 GTI (incl. Location SE of Denver. GOLFMK8 Nov 3, 2017 · I’ve heard of people blowing their turbos from running a downpipe on the stock tune and cars running too lean/rich on stocktunes with downpipes. r/GolfGTI is a place for enthusiasts to discuss, ask questions, and share information about the best car that can be had for less than $40K. Just got a resonator delete. Downpipes are also pretty simple. If the tune it taken back to stock how do they will even the best pipes pass inspection? I have Unitronic stage 1+ with stock downpipe and exhaust. Obviously, everyone has different taste though. Stock Airbox Grate Removal; Stock Airbox with aFe The ARM MK7 GTI Downpipe is an essential upgrade if you're looking to get the most from your Gen 3 EA888 equipped GTI. VW - GTI MK7 2. 00" (76. 0T engine (FWD only)* VW - Golf MK7. This is not an unexpected result given the two catalytic converters that the stock GTI downpipe is equipped with compared to one on the ARM downpipe, along with the smaller diameter piping of the stock downpipe. instagram. Mk7 GTI Charge Pipes; Mk7 GTI Downpipe Testing; Mk7 GTI Exhaust Tests; Mk7 GTI FMIC Tests; Mk7 Intake Manifold Tests; Mk7 GTI Intercooler Test; Mk7 Radiator Tests; Mk7 Turbo Inlet Hose Test; Mk7 Turbo Inlet Elbow Tests; Mk7 GTI Turbo Muffler Delete; Airflow Menu Toggle. Location USA Car(s) 17 S3 - 2019 GTI Urano gray MK7 Catted Downpipe by MAPerformance – MK7/MK7. Brand: ES#: 3969682 Mfg#: SVWX043 Jul 19, 2021 · Mk7 GTI Tunes Menu Toggle. Mar 3, 2025 · We are proud to release the new CTS Turbo 3. Shop from the best aftermarket high flow, high quality MK7 GTI downpipes at the lowest price on the web, guaranteed thanks to the MAPerformance Nov 14, 2022 · Trackslag and ARM Downpipe Swap Test Procedure: Wheel horsepower will be estimated using the Virtual Dyno software program. Basically Palladium is in major shortage and our mk7 (GTI R etc) down pipes are falling victim to being sold to scrappers and cut up for the metal in the cats. com. 5" Stainless Steel downpipe for the MK7 GTI & GLI. 5" High Flow Downpipe (Mfg#CTSEXHDP0014CAT) fits Volkswagen Golf VII 2. 5" GTI Downpipe is an essential upgrade if you're looking to get the most from your Gen 3 EA888 equipped GTI. Our products include performance parts, replacement parts, OEM parts, lighting products Jun 23, 2015 · 2018 Mk7. 0T Raceland Downpipe. But I also can't justify spending near a thousand dollars for a pipe that connects the turbo to the main exhaust. The catless Trackslag downpipe flowed 573 CFM @ 16″ of H2O. Should I change the spacer and swivel the J spacer Into the upward position so r/GolfGTI is a place for enthusiasts to discuss, ask questions, and share information about the best car that can be had for less than $40K. All of these options are within a couple hundred bucks so cost is not a super important variable right now. I'm not eager to take it all apart (if I have to) but I'll do it if it's what is recommended. System comprises of: - Downpipe with 200 Cell Sports Cat or De-Cat - Fitting Kit Notes: - Engine management light may be activated if not used in conjunction with the correct performance software Feb 14, 2021 · We install a CTS Catless Downpipe on my friend Jordan's Mk7 GTI Build! We show you how to install a downpipe on your Mk7 GTI and then show how the new catles Sep 16, 2018 · 2017 GTI Sport - DSG - Pure White Engine : EQT Vortex + Tune, Integrated Engineering Intercooler, Downpipe, & Carbon Intake, CTS Catback, BFI Stage1 Mounts Suspension : VWR Springs, Koni Sport Shocks/Struts, H&R 24mm RSB, StopTech ST-60 BBK, Neuspeed RSE10 & Michelin Pilot Sport 4s Jun 17, 2014 · Golf GTi MK7 Down Pipe Installation and review by Gregv Finally installed the downpipe and wanted to do a comparison. 0T engine (FWD only)* *This downpipe system includes a mid pipe that is specially designed to fit Gen 3 1. Jan 20, 2022 · Right now I have a Borla Catback installed on my 2017 Mk7 R. Will be getting protune once my clutch is installed. 90 Dragy Feb 21, 2018 · A downpipe on a MK7 without a tune WILL 100% make the car run lean. Replacing your OEM downpipe with the ARM MK7 GTI Downpipe will significantly improve exhaust flow, reducing the back-pressure generated by your turbocharger. The stock downpipe is built with a dense catalyst that hinders exhaust flow on your EA888 engine, causing higher back-pressure, increasing turbo lag and causing your turbo to work harder. Mk7 GTI Stg2 Tune Overview; Cobb OTS Stg2 Tunes; Mk7 GTI Air Intake; Mk7 GTI Charge Pipes; Mk7 GTI Downpipe Testing; Mk7 GTI Exhaust Tests; Mk7 GTI FMIC Tests; Mk7 Intake Manifold Tests; Mk7 GTI Intercooler Test; Mk7 Radiator Tests; Mk7 Turbo Inlet Hose Test; Mk7 Turbo Inlet Elbow Tests; Mk7 GTI Turbo Muffler Delete We are proud to release the new CTS Turbo 3. 2015 MK7 GTI - Pearl Black - DSG Tune plus DP plus fmic will be the best hp per dollar on this platform and Sep 27, 2018 · 2016 GTI SE w/ LP, PP, and DCC JB4 | Baun Performance FMIC | MAPerformance GESI Catted/Resonated DP | DKM Stage 3 Twin Disk Clutch | Iabed RMS | BFI Stage 1 Dogbone Insert | IE CF Intake & Inlet Pipe | CTS Turbo Inlet Pipe | Neuspeed Rse10 19x8 on PS4s | BFI Weighted Shift Knob | Euro Short Shifter | WCT pedal spacer | 42DD Shifter Bushings | OEM Mud Guards | Euro non-led tails w/ Amber turns. Featuring 3" tubing throughout with a massive 3. The result of the increased exhaust flow is a faster turbo spool I’m sure this has been done to death but I’m looking for some good catted downpipe recommendations for my mk7 gti. 5 gti se and I’ve been looking for a downpipe that wouldn’t make the car sound horrible or like a fart can but it’s hard to find any videos on the exact exhaust system I have so I came here looking for help :) Jun 14, 2024 · Hi MK7 friends, After talking to a few nice members here and taking their suggestions based on some video clips and info I am leaning towards going with a catted downpipe and stage 2 tune. 5 GTI for someone who wants an aggressive exhaust but no drone. Nov 26, 2018 · I read many reviews of downpipes, expensive and affordable, and the consensus was "a pipe is a pipe, as long as they use good material, it should work fine and last long" and noticed that no one had any reviews on affordable or ebay purchased catted mk7 downpipes. But for manual transmission guys we can’t even tune because of this shit clutch. It is highly recommended that you do go stage 2 once installing a downpipe to ensure the car runs correctly and to utilize the downpipe fully. Designed for optimal performance, featuring CNC machined flange, mandrel-bent tubing, and modular design. Apr 28, 2021 · Just thought i would make this thread as i have got rather frustrated with trying to find a decently priced used Mk7/Mk7. Adding a downpipe without a tune will push the ECU out of its comfort Scorpion Downpipe and Cat / De-Cat - Volkswagen Golf Mk7 GTI Features: - 3" Diameter Stainless Steel Pipework - Stage 2 Remap Required. I also considered the ARM downpipe, and the IE downpipe. Stock Parts Menu Toggle. Running an APR DTR6054 turbo on their 93 octane tune (stock downpipe). For now I am flashed to stock map. I'm trying to replace the OEM downpipe on my 2020 Golf GTI and I ran into what seems to be a show stopper. Easy and direct installation. I ended up removing the reducers and installing a 3 inch link pipe to connect the downpipe to the catback; AWE (Touring) Catback with STOCK downpipe PROS: None really, besides quality; CONS: Almost stock sounding (maybe "OEM+") Sep 10, 2016 · 2016 Mk7 GTI S Midnight Blue 2dr 6MT | LP | Unitronic Stage 2 | Bull-X Catted Downpipe | Unitronic Cat Back | Unitronic Intercooler | Southbend Stage 3 Daily Clutch | VWR Drop in Filter | BFI Stage 1 Engine Mount | BFI Stage 1 Transmission Mount | 034 Dogbone Mount Insert | Rs7 Spark Plugs Mar 4, 2018 · Thanks. 5 GTI equipped with the 2. I have e85 about 6 miles away from me so a blend is very possible to do at a normal fill up rate. The cat is a 100 cell metal cat instead of the stock 400 cell (which is ceramic I think). However, we can’t really recommend this route to anyone. Get a 316 SS or even better 318 SS if you live near a beach or in a snowy climate. You can equip this part on a bone stock Mk7 GTI and notice instant improvements in throttle response from reduced back-pressure 2015 – 2021 MK7 / MK 7. 8TSI (incl. The factory downpipe severely restricts exhaust flow and therefor has adverse effects on horsepower, especially once your car is "chipped". Which is why I got Vibrant midpipe. grhlgqmrtnubstxizbqcamaeeetjinopxrbfjsdobfkpnnnktlqinhngpiaaykggtnwfmqlvvmg